PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013616289.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 486aa    MW: 53682.8 Da    PI: 6.2299
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013616289.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.8e-164491148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+d+vk++G g+W+t+ ++  + R++k+c++rw ++l
   XP_013616289.1 44 KGPWTSTEDGILIDYVKRHGEGNWNTVQKHTSLARCGKSCRLRWANHL 91
                     79******************************************9986 PP

2Myb_DNA-binding50.16.6e-1697140146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v+ ++++G++ W+  a++++ gRt++++k++w++
   XP_013616289.1  97 KGAFSKEEEQLIVEMHARMGNK-WAQMAEHLP-GRTDNEIKNYWNT 140
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.9273991IPR017930Myb domain
SuperFamilySSF466891.09E-2843138IPR009057Homeodomain-like
SMARTSM007177.6E-114393IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-224598IPR009057Homeodomain-like
CDDcd001673.25E-94691No hitNo description
PfamPF139216.8E-1547107No hitNo description
PROSITE profilePS5129425.07992146IPR017930Myb domain
SMARTSM007172.1E-1696144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2499145IPR009057Homeodomain-like
CDDcd001676.18E-1299140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MSYTMVTDES DDAMYSSIYN ESPSAADNIG SGCTSRGKGS VLKKGPWTST EDGILIDYVK  60
RHGEGNWNTV QKHTSLARCG KSCRLRWANH LRPNLKKGAF SKEEEQLIVE MHARMGNKWA  120
QMAEHLPGRT DNEIKNYWNT RIKRRQRAGL PLYPPGTHVE DLHWSQEYHP STSNVTGVDR  180
RRHQDILQLA NSKANVLFDD LNFANVLFED LNFATSLLPV ASHISDMFSC NMLGTGASSS  240
SRYESYTPPI LPSPKQLGGS GSLFNIRQEF QSPQKNPRSC SISDHPMYGN HHQSDVMIQD  300
SHHTFTDGMV PTSKPLFGAV KLELPSFQYS EASGFDQWKT TTPSPPQSDL LDSVDTYIQS  360
PPPLEIDEPD CFSSCDTGLL DMLLHEAKIK ASAKHSFSST ACITDGTQDV PRGGETHNIT  420
SGAGGNSSAF AVVKTEELDQ VWEPKRADVV RPDVLLASSW QDQQGRFGIV RDSSSLSDAL  480
ALLLGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32421455107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013616281.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_013616289.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_013719059.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_013719060.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_013719061.10.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_013719062.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLA0A0D3AEG90.0A0A0D3AEG9_BRAOL; Uncharacterized protein
STRINGBra002042.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.10.0myb domain protein 65